Skip to content
Back to library
Scientific

HEXACO and the Dark Triad: Narcissism, Machiavellianism, and Psychopathy

How HEXACO predicts dark personality traits. The H factor as the common core, research by Paulhus, Lee & Ashton, and implications for organizations.

hexacodark-triadnarcissismmachiavellianismpsychopathypersonalityantisocial

HEXACO and the Dark Triad: Narcissism, Machiavellianism, and Psychopathy

The Dark Triad — narcissism, Machiavellianism, and psychopathy — designates a trio of subclinical personality traits particularly harmful in human relationships. Together, these traits predict manipulation, exploitation, lack of empathy, and deep egocentrism.

HEXACO's major contribution in this domain: it allows better prediction and measurement of these traits than the Big Five, thanks to its Honesty-Humility factor.


Understanding the Dark Triad

Definitions

Subclinical narcissism: grandiosity, excessive need for admiration, sense of entitlement, lack of empathy. Distinct from Narcissistic Personality Disorder (clinical) — these are traits present to varying degrees in the general population.

Machiavellianism: tendency to manipulate others for one's own ends, interpersonal cynicism, moral pragmatism ("the end justifies the means"), cold strategic planning.

Subclinical psychopathy: impulsivity, callousness toward others' emotions, absence of remorse, risk-seeking, antisocial behaviors without regard for consequences.

All three traits share a common core: a fundamental lack of concern for others. This is where the H factor comes in.

The Dark Tetrad

In 2010, Buckels, Jones & Paulhus proposed adding a fourth trait: subclinical sadism — pleasure derived from others' suffering, even without personal benefit. This trait forms the "Dark Tetrad" with the other three.


The H Factor as Common Core

Lee & Ashton's Research

Lee & Ashton (2005, 2014) showed that Honesty-Humility is negatively and strongly correlated with all three Dark Triad traits:

TraitCorrelation with H
Narcissismr = −0.45 to −0.60
Machiavellianismr = −0.55 to −0.70
Psychopathyr = −0.40 to −0.55

These correlations are significantly larger than what the Big Five can achieve with its dimensions.

Why H Predicts Better Than Big Five

In the Big Five, dark traits are distributed mainly across:

  • Low Agreeableness (A-)
  • Low Conscientiousness (C-)
  • Variable Neuroticism

But this distribution dilutes the signal. A Machiavellian can score normally on C (they are organized, methodical — in service of their own goals). A narcissist can score normally on A (they can be superficially charming).

The H factor captures the common core uniting all three traits: the absence of moral scruple, willingness to exploit others, and contempt for fairness. All four facets of H — sincerity, fairness, greed avoidance, modesty — are violated by dark profiles.


Narcissism and HEXACO

Narcissism Seen Through H

Subclinical narcissism is characterized by:

  • Low modesty: grandiosity, conviction of being exceptional
  • Low greed avoidance: intense desire for status, wealth, recognition
  • Low sincerity: performing an image, manipulating others' perceptions
  • Low fairness: rules apply to others but not to oneself

Extraversion and Narcissism

Paulhus & Williams (2002) noted that narcissism is positively correlated with Extraversion. Narcissists are often charismatic, socially dominant, at ease in groups. They occupy space.

In HEXACO, a typical narcissistic profile therefore presents:

  • Very low H
  • High X
  • Moderate to high C (they can be very organized and disciplined in their ambitions)
  • Low E (little anxiety, strong sense of control)

This pattern is difficult to identify in the Big Five because the combination low A + high E can be confused with a simply extraverted and disagreeable person.


Machiavellianism and HEXACO

The Machiavellian as Moral Strategist

Machiavellianism is characterized by a cold, calculating view of human relationships. Machiavellians:

  • Manipulate others to achieve their goals
  • Adopt deep interpersonal cynicism ("people are motivated by self-interest")
  • Plan long-term influence strategies
  • Show no remorse for their tactics

HEXACO Profile of the Machiavellian

DimensionTypical score
HVery low
EVariable (may or may not be anxious)
XVariable (introverted or extraverted)
ALow to moderate
COften high (disciplined, organized)
OVariable

The distinctiveness of Machiavellianism compared to other dark traits: it is the most cognitive trait. The Machiavellian is not necessarily impulsive (unlike subclinical psychopathy) — they are deliberate.


Subclinical Psychopathy and HEXACO

Two Dimensions of Psychopathy

Contemporary research distinguishes two factors in psychopathy:

Factor 1 (Primary Psychopathy): emotional callousness, lack of empathy, superficial charm. Correlates strongly with low H.

Factor 2 (Secondary Psychopathy): impulsivity, irresponsible lifestyle, antisocial behaviors. Correlates with low E and low C.

HEXACO vs Big Five in Predicting Psychopathy

Studies by Maples et al. (2014) showed that Big Five underpredicts Factor 1 psychopathy precisely because it lacks the integrity factor. A primary psychopath may score normally on Agreeableness (they can appear likable on the surface) but will always score very low on H.


The Dark Tetrad: Subclinical Sadism

What Subclinical Sadism Is

Subclinical sadism — distinct from clinical sexual sadism — refers to pleasure derived from cruelty, humiliation, or others' suffering, even without concrete benefit. It includes:

  • Unjustified online cruelty (trolling, cyberbullying)
  • Pleasure from violent content in media
  • Tendency to humiliate or belittle others "for fun"

Its Link to H

Subclinical sadism correlates very strongly with low H, but also with low Emotionality. Subclinical sadists do not experience the distress that most people would feel when causing pain — their low E makes them impervious to others' emotional distress signals.


Why Big Five Under-Detects These Traits

The Fragmentation Problem

As explained, dark traits are fragmented in the Big Five across A, C, and N. This fragmentation creates several problems:

  1. False positives: someone simply low in agreeableness (low A but normal H) can be confused with a dark profile
  2. False negatives: a charismatic, organized narcissist can score normally on A and C
  3. Lack of specificity: it is impossible to distinguish the different dark traits based on Big Five alone

The HEXACO Solution

H as a unifying dimension allows:

  • Direct measurement of the common core
  • Better distinction between the three traits (combining H with other dimensions)
  • Greater resistance to faking (it is harder to fake H than A)

Implications for Organizations

Identifying At-Risk Behaviors

Research by Bourdage et al. (2012) and Zettler & Hilbig (2010) showed that H is the single best predictor of:

  • Counterproductive work behaviors (CWBs)
  • Interpersonal organizational deviance
  • Fraud and theft
  • Workplace harassment

Limits of HR Use

See the HEXACO and Career article for ethical precautions. In summary:

  • A low H score does not mean a person will commit unethical acts
  • Situational contexts play a major role
  • Using this data in hiring decisions raises legal and ethical questions

Utility in Training

Conversely, raising team awareness about dark traits — through training on behavioral dynamics — can help identify and manage problematic behaviors without stigmatizing individuals.


Subclinical vs Clinical: An Essential Distinction

All Dark Triad/Tetrad traits exist on a continuum. Subclinical forms:

  • Are present to varying degrees in the general population
  • Do not constitute diagnosed personality disorders
  • Do not necessarily require treatment
  • Can be associated with professional success in certain contexts

Clinical forms (Narcissistic Personality Disorder, Antisocial Personality Disorder) are psychiatric diagnoses with strict criteria and significant functional impacts.

HEXACO measures subclinical traits. It is not a clinical diagnostic tool.


Connection with Shinkofa

Shinkofa integrates research on dark traits in a nuanced personal development perspective. The platform does not label users as "dark" or "dangerous" — that would be as inaccurate as it is unethical.

However, understanding one's H score allows awareness of one's tendencies:

  • A low H may signal a tendency to prioritize one's own interests, minimize rules, feel "above" ordinary constraints
  • A high H may signal a tendency toward excessive moral consciousness, difficulty defending one's legitimate interests

In Shinkofa, this profile dialogues with Human Design: the G center (identity/direction) in Human Design illuminates the question "are you acting from your true self or from conditioning?" — a question deeply related to integrity as HEXACO measures it.

The goal is lucidity, not judgment.

Related articles